PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012569710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 440aa    MW: 48604.1 Da    PI: 4.9012
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012569710.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.7e-34215269155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rW+peLHe+Fveav+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  XP_012569710.1 215 KPRMRWSPELHEAFVEAVNQLGGSEKATPKGVLNLMKVEGLTIYHVKSHLQKYRT 269
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.053212272IPR017930Myb domain
SuperFamilySSF466892.87E-17213269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-31213271IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-24215269IPR006447Myb domain, plants
PfamPF002491.9E-9217268IPR001005SANT/Myb domain
PfamPF143793.1E-20303347IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MPSSSPVLPT LMESKYLKPP DSLQCSPIRG LTANPASLQA TSSSPIRSVG PVLLSNAECP  60
GSIPFSSVSQ HDRRYQDSSF ASQTLGDSTS SEIHSTTFTS LPQENGDISW GPDPMEDILS  120
FPEMFSVQHD QVENIAGYMN DDNAKKSDFG EWVEQLMTID DSLHPNWNQL LDDDDNVAEP  180
TPKANQVSPK QQHIPSGEVN GLCNSASAST APQTKPRMRW SPELHEAFVE AVNQLGGSEK  240
ATPKGVLNLM KVEGLTIYHV KSHLQKYRTA RYKPESSEEG TSEKKMNSIE DVKSLDLKTS  300
KGITEALRLQ MELQKRLHEQ LEIQRKLQIQ IETQGKHLQM MFEKQKQMGD NKGSLSPSNA  360
PSATLLDTGL PSSPANNSKT SNDEGDKLRC NTDISKAIPE ESFENASRNL MVDEAEVTNE  420
HERVDDQFSA IPPTKRAKIQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494732.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_004494734.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_012569710.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A072UFL50.0A0A072UFL5_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA03G41040.30.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-89G2-like family protein